SPM_001820


  Uniprot: A0A037UT42
Description: tRNA-binding protein
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 23,485
Subunit structure [CC]: 
Gene ontology (GO): tRNA binding [GO:0000049]
Gene ontology IDs: GO:0000049
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Contains tRNA-binding domain. {ECO:0000256|SAAS:SAAS00514390}.
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 90 201 TRNA-binding. {ECO:0000259|PROSITE:PS50886}.
Motif: 
Region: 
EMBL: AGBZ02000001
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92775
UniPathway: 
CDD: 
Gene3D: cd02796
HAMAP: 2.40.50.140
InterPro: 
PANTHER: IPR012340;IPR002547;IPR033714
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS50886
ProDom: PF01588
SMART: 
SUPFAM: 
TIGRFAMs: SSF50249
333506-334136(-)

>nucleotide sequence
TTAATTTTGCCCATTATAATATTCCTTTCAAAAACTATTTCCAAGGTGATATTGCTGATT
TGATAATAACATAATTTTTTTACCAATAATAGTAACTGGCAATCCTAATTCTCGTTCAGA
ACAAAGCATTCCATTTGAAATAACTCCTCGTAATTCACTAGGAACAATTTTTAAACCTGA
TGGCATAATCGCCCCAACACGTGCAACAACAACTAATTGGTCAATATCACAATTATCAGC
TCCACAAATAATTTGTTCAGTTGACAAACCAATATCTACTTGGCAAATATTTAATTTATC
AGAATTAGGATGTTTTTTGCGTTCAAGAATTTTACCAACGATAAATTGTGGTTGTTGATT
AATATTATTAAAAGAATAATCTTCTTGTTTAAAAATAGTTCCTAACTCTGCTAATAAATC
ATAATTATCATTATTAATACCTAACTTTAAAGGTACTGTTAAATGCTTACTAGCATTTAG
CAAATTAAACCCGCAACATTGGTGATCTTGATTATAAAATAAAACATAATCATTATTAAT
AACATACTCAACCTTATCAGGTGTTGATTCATATCCAATCAAAACATCAAAGCCTTGATT
ATAAAATAAACCAATTGTTTTTGTTCCCAT


>protein sequence
MGTKTIGLFYNQGFDVLIGYESTPDKVEYVINNDYVLFYNQDHQCCGFNLLNASKHLTVP
LKLGINNDNYDLLAELGTIFKQEDYSFNNINQQPQFIVGKILERKKHPNSDKLNICQVDI
GLSTEQIICGADNCDIDQLVVVARVGAIMPSGLKIVPSELRGVISNGMLCSERELGLPVT
IIGKKIMLLSNQQYHLGNSFWKEYYNGQN






















© Fisunov Lab of Proteomics, 2016.