SPM_001900


  Uniprot: A0A037UN60
Description: potassium uptake protein KtrA
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 26,051
Subunit structure [CC]: 
Gene ontology (GO): cation transmembrane transporter activity [GO:0008324]; potassium ion transport [GO:0006813]
Gene ontology IDs: GO:0006813; GO:0008324
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 6 130 RCK N-terminal. {ECO:0000259|PROSITE:PS51201}.; DOMAIN 139 223 RCK C-terminal. {ECO:0000259|PROSITE:PS51202}.
Motif: 
Region: 
EMBL: AGBZ02000001
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92787
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.30.70.1450;3.40.50.720
InterPro: 
PANTHER: IPR016040;IPR006037;IPR003148
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS51202;PS51201
ProDom: PF02080;PF02254
SMART: 
SUPFAM: 
TIGRFAMs: SSF116726;SSF51735
345811-346513(+)

>nucleotide sequence
ATGGCACGAAGAAAAAGTTTTGCAATTATTGGACTAAATAATTTTGGACGTTCAATAATT
GAAACACTAATTGCGCGAAAACAACATATTATGGTCTTTGATATTGACCAAACTAAGGTT
AATAATATGATTGCTAGTTATGATCAAGTTGATGGAGTAGCATTAGATGCAACAGTTAAA
ACAAATCTAATTGAACAAGGACTAGACGAATATGATACTGTCATTATCACAATCGCAAGT
AATATTGAAGCTAGTATTTTAACAATTATTGGGTTGCAAGACCTTGGAATTACTAATATT
ATTGCGAAAGTAAAAGATATTCGTCATGCGCGAATTCTAAAAGCATTAGGAATTAATAAT
ATTATCCAACCCGATACAATGGCCGGAAGCATTACTGCAACTAAAGCAATGTTTGATATT
GACATTGAAATGCAAACTGTTGATGAAAATTATGCATCATTAATTATTCAAGTGACTGAT
CCAAATATTGAAGGACAAACATTATCAGAATTACGTTTTATTAATAATAAAGATTATAAT
ATTGTTTATGTTAAACGTAAAGGCCGCGTTATTTTACCCGGAGATGTTGAAACAATTAAA
TTAGATGATGAATTATTATTTATTGCTAAAATTAGTGCAATTAATGATTTAACAATTAAA
TTACAAAAAATTGACCAAGAATATGAAAAAGATGGTAAATAA


>protein sequence
MARRKSFAIIGLNNFGRSIIETLIARKQHIMVFDIDQTKVNNMIASYDQVDGVALDATVK
TNLIEQGLDEYDTVIITIASNIEASILTIIGLQDLGITNIIAKVKDIRHARILKALGINN
IIQPDTMAGSITATKAMFDIDIEMQTVDENYASLIIQVTDPNIEGQTLSELRFINNKDYN
IVYVKRKGRVILPGDVETIKLDDELLFIAKISAINDLTIKLQKIDQEYEKDGK






















© Fisunov Lab of Proteomics, 2016.