SPM_001905


  Uniprot: A0A037UQF9
Description: glutamyl-tRNA amidotransferase
EC number: 6.3.5.-
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: ATP + L-aspartyl-tRNA(Asn) + L-glutamine = ADP + phosphate + L-asparaginyl-tRNA(Asn) + L-glutamate. {ECO:0000256|HAMAP-Rule:MF_00121, ECO:0000256|SAAS:SAAS00247554}.; CATALYTIC ACTIVITY: ATP + L-glutamyl-tRNA(Gln) + L-glutamine = ADP + phosphate + L-glutaminyl-tRNA(Gln) + L-glutamate. {ECO:0000256|HAMAP-Rule:MF_00121}.
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000256|HAMAP-Rule:MF_00121, ECO:0000256|SAAS:SAAS00387483}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): gatB
Gene names (synonym): 
Mass: 54,927
Subunit structure [CC]: SUBUNIT: Heterotrimer of A, B and C subunits. {ECO:0000256|HAMAP-Rule:MF_00121, ECO:0000256|SAAS:SAAS00247550}.
Gene ontology (GO): ATP binding [GO:0005524]; glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity [GO:0050567]; transferase activity [GO:0016740]; translation [GO:0006412]
Gene ontology IDs: GO:0005524; GO:0006412; GO:0016740; GO:0050567
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the GatB/GatE family. GatB subfamily. {ECO:0000256|HAMAP-Rule:MF_00121, ECO:0000256|SAAS:SAAS00548356}.
Protein families: GatB/GatE family, GatB subfamily
Coiled coil: 
Domain [FT]: DOMAIN 327 474 GatB_Yqey. {ECO:0000259|SMART:SM00845}.
Motif: 
Region: 
EMBL: AGBZ02000001
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92788
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 
InterPro: MF_00121
PANTHER: IPR004413;IPR017959;IPR006075;IPR018027;IPR003789;IPR017958
PIRSF: PTHR11659
PRINTS: 
PROSITE: 
Pfam: PS01234
ProDom: PF02934;PF02637
SMART: 
SUPFAM: SM00845
TIGRFAMs: SSF89095
346523-347966(-)

>nucleotide sequence
TTATTTTCCTTCTTTTGCCATAATTAATTCAATAACTACTTGTTGACCAATTTCTGGTGC
AACCTGTCCTTTTGTTAATTTCATTAATTCACCCATAAAAAACTTAATTACTCGTTCTGG
TCGTTGTTCATATTGTTCTAACATTGCTATATTAGCATTAAAAACTGGCTCAATAATTGC
TTTAATCTCAACTGGATCACTAATTTGTTTTAATCCTAATTCAGTAACAATTTTAGTTGG
AGGACAATCTTCATTTAAAATTCGTTGGAGCACTGTTTTAGCCTGCTTATTTGAAATTAC
ATTTTGATTAATTAACATAATCATTTCAACTAAATTTTGTGGTGTTAATGCTGTTTCAGT
TATTGTTAATCCCTTTTGGTTTAAATAAGCACTAATATCACCAATTAAATAATGCGCAAT
CATTTCATAATGTGGTGATAACTTAATTGCTGCTTCAAAAAAATTCATTAAAGTATAATC
TTGTAAAATAATTTCAATATCGTCTGGCTTTAACTTTAATTTTGATAAATAACGTTCCCG
CTTGACAGCTGGTAATTCTGGCATATTTTTAAGAACTTTTGCCATTCAATTTGGATCTAA
TTTAATTGGAAAAATATTTGGCTCAGAAAAATACTTATAATCAATTGCATCAGTTTTATG
ACGCATTAAAACTGTTGTTTTTGTTTTTTCATCAAATCGTCGTGTTTCTTGTTCAATTCT
TTTTCCTATTAAAAAAAGTTCACTTTGTCTTTTAATTTCATATTCAATTGCCTTTTCAAC
ATTTGCAATTGAATTAAGGTTTTTTAATTCAACCTTATCACCAAATGTTTTCGCACCAAC
TGGCCGTAACGAAATATTAACATCACATCGTAATGAACCCTCATTCATTTTAGCATCACT
AACTTTGGTATAAACTAAAATCTCACGTAAAGTTTCTAAATATTGACGAACTTGAAATGC
TGACCGTAACACGGGACGGGTTACGATTTCAATTAAACCAATTCCAGCGCGATTATAATC
TAATAATGTTCAATCTTCCTCATGTAACTGTTTGGCAGTATCTTCTTCGATATGTAATCG
TTCAATTTCTACTTTAAAAGGTTTACCATTTTCATCAATAATGGTTAAATAGCCATTTTT
ACCAATTGGATAATATTGCTGCGTAATTTGAAAACCCTTGGCTAAATCAGGATAATAATA
ATTTTTACGATCAAATTGAACAATTGGATCAATTGTTAAATTAAGTGCTTGGCAAGCAAT
TAATGCTAACTCAACCCCTTTTTTATTAACTGTTGGCATTACTCCCGGATATCCAGCATC
CATCGGATTAACCATACTATTGGGCTGAGCTCCATAACTAACTGCTCCAGAAGAAAACAT
TTTTGTCTTTGTTTTTAATTCAACATGATTTTCAATCCCAATTACTACTTCAAAATTAAC
CAT


>protein sequence
MVNFEVVIGIENHVELKTKTKMFSSGAVSYGAQPNSMVNPMDAGYPGVMPTVNKKGVELA
LIACQALNLTIDPIVQFDRKNYYYPDLAKGFQITQQYYPIGKNGYLTIIDENGKPFKVEI
ERLHIEEDTAKQLHEEDWTLLDYNRAGIGLIEIVTRPVLRSAFQVRQYLETLREILVYTK
VSDAKMNEGSLRCDVNISLRPVGAKTFGDKVELKNLNSIANVEKAIEYEIKRQSELFLIG
KRIEQETRRFDEKTKTTVLMRHKTDAIDYKYFSEPNIFPIKLDPNWMAKVLKNMPELPAV
KRERYLSKLKLKPDDIEIILQDYTLMNFFEAAIKLSPHYEMIAHYLIGDISAYLNQKGLT
ITETALTPQNLVEMIMLINQNVISNKQAKTVLQRILNEDCPPTKIVTELGLKQISDPVEI
KAIIEPVFNANIAMLEQYEQRPERVIKFFMGELMKLTKGQVAPEIGQQVVIELIMAKEGK






















© Fisunov Lab of Proteomics, 2016.