SPM_003375


  Uniprot: A0A037UMD9
Description: translation initiation factor IF-3
EC number: 
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: IF-3 binds to the 30S ribosomal subunit and shifts the equilibrum between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins. {ECO:0000256|HAMAP-Rule:MF_00080, ECO:0000256|RuleBase:RU000646, ECO:0000256|SAAS:SAAS00024305}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): infC
Gene names (synonym): 
Mass: 20,456
Subunit structure [CC]: SUBUNIT: Monomer. {ECO:0000256|HAMAP-Rule:MF_00080, ECO:0000256|RuleBase:RU000646, ECO:0000256|SAAS:SAAS00024311}.
Gene ontology (GO): cytoplasm [GO:0005737]; translation initiation factor activity [GO:0003743]
Gene ontology IDs: GO:0003743; GO:0005737
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the IF-3 family. {ECO:0000256|HAMAP-Rule:MF_00080, ECO:0000256|RuleBase:RU000646, ECO:0000256|SAAS:SAAS00544369}.
Protein families: IF-3 family
Coiled coil: COILED 74 98 {ECO:0000256|SAM:Coils}.
Domain [FT]: DOMAIN 14 82 IF3_N. {ECO:0000259|Pfam:PF05198}.; DOMAIN 91 175 IF3_C. {ECO:0000259|Pfam:PF00707}.
Motif: 
Region: 
EMBL: AGBZ02000001
ProteinModelPortal: A0A037UMD9
MEROPS: 
EnsemblBacteria KO: KAI93019
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.10.20.80;3.30.110.10
InterPro: MF_00080
PANTHER: IPR019813;IPR001288;IPR019815;IPR019814
PIRSF: PTHR10938
PRINTS: 
PROSITE: 
Pfam: PS00938
ProDom: PF00707;PF05198
SMART: 
SUPFAM: 
TIGRFAMs: SSF54364;SSF55200
635619-636150(+)

>nucleotide sequence
ATGAATCAACCCACTAAAAACAATAAAAATATCGAGCAAGTAAATTATGATATTAGAGCA
CGTGAAGTTTTAATTATTTTAGATGATGGTAACAAAGTTGGTCCTTTAGGGAGAAATGAA
GCAATTCGTTTTGCTGAAGAAAAAGGTTTAGATTTATTGTTGGTATCAGCTGCTTCAAAT
CCACCGGTAGCAAAATTGGTTGATTATGGAAAATATAAATACGAACAAAAGAAAAAAGAA
AAAGAAAATAAGAAAAATCAACATATAACTGAAAATAAAGAGATGCGTTTACGAACAGGA
ATTGGTGAACATGATTTGGAATTTAAAGCAAAAAAAGTGCGTGAATTTCTAACTGATGGG
AATCGTGTTAAAATTTCTTTAAAGTTTCGTGGTCGAGAAGTTGCTAGACCTGAATATGGA
AAAGAAACATTAGATAAGTTTTTTAGTTATATTGAAGATTTGGCAAAGATTGAAAAAGAA
CCACAATTAAATGGCTTGTTTTTAGATATGTATGTTGTACCAAAAAAATAA


>protein sequence
MNQPTKNNKNIEQVNYDIRAREVLIILDDGNKVGPLGRNEAIRFAEEKGLDLLLVSAASN
PPVAKLVDYGKYKYEQKKKEKENKKNQHITENKEMRLRTGIGEHDLEFKAKKVREFLTDG
NRVKISLKFRGREVARPEYGKETLDKFFSYIEDLAKIEKEPQLNGLFLDMYVVPKK






















© Fisunov Lab of Proteomics, 2016.