SPM_004110


  Uniprot: A0A037UKM7
Description: DNA gyrase subunit B
EC number: 5.99.1.3
Annotation score: 3 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: ATP-dependent breakage, passage and rejoining of double-stranded DNA. {ECO:0000256|HAMAP-Rule:MF_00939, ECO:0000256|SAAS:SAAS00470725}.
Cofactor: COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000256|HAMAP-Rule:MF_00939}; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000256|HAMAP-Rule:MF_00939}; Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000256|HAMAP-Rule:MF_00939}; ; Note=Binds two Mg(2+) per subunit. The magnesium ions form salt bridges with both the protein and the DNA. Can also accept other divalent metal cations, such as Mn(2+) or Ca(2+). {ECO:0000256|HAMAP-Rule:MF_00939}
Enzyme regulation: 
Function [CC]: FUNCTION: Topoisomerase IV is essential for chromosome segregation. It relaxes supercoiled DNA. Performs the decatenation events required during the replication of a circular DNA molecule. {ECO:0000256|HAMAP-Rule:MF_00939}.
Pathway: 
Active site: 
Binding site: BINDING 10 10 ATP. {ECO:0000256|HAMAP-Rule:MF_00939}.; BINDING 50 50 ATP. {ECO:0000256|HAMAP-Rule:MF_00939}.; BINDING 77 77 ATP. {ECO:0000256|HAMAP-Rule:MF_00939}.; BINDING 341 341 ATP. {ECO:0000256|HAMAP-Rule:MF_00939}.
Calcium binding: 
DNA binding: 
Metal binding: METAL 430 430 Magnesium 1; catalytic. {ECO:0000256|HAMAP-Rule:MF_00939}.; METAL 503 503 Magnesium 1; catalytic. {ECO:0000256|HAMAP-Rule:MF_00939}.; METAL 503 503 Magnesium 2. {ECO:0000256|HAMAP-Rule:MF_00939}.; METAL 505 505 Magnesium 2. {ECO:0000256|HAMAP-Rule:MF_00939}.
Nucleotide binding: NP_BIND 117 123 ATP. {ECO:0000256|HAMAP-Rule:MF_00939}.
Site: SITE 455 455 Interaction with DNA. {ECO:0000256|HAMAP-Rule:MF_00939}.; SITE 458 458 Interaction with DNA. {ECO:0000256|HAMAP-Rule:MF_00939}.; SITE 510 510 Interaction with DNA. {ECO:0000256|HAMAP-Rule:MF_00939}.; SITE 624 624 Interaction with DNA. {ECO:0000256|HAMAP-Rule:MF_00939}.
Gene names (primary): gyrB
Gene names (synonym): parE
Mass: 72,182
Subunit structure [CC]: SUBUNIT: Heterotetramer composed of ParC and ParE. {ECO:0000256|HAMAP-Rule:MF_00939}.
Gene ontology (GO): chromosome [GO:0005694]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA topoisomerase type II (ATP-hydrolyzing) activity [GO:0003918]; magnesium ion binding [GO:0000287]; chromosome segregation [GO:0007059]; DNA topological change [GO:0006265]
Gene ontology IDs: GO:0000287; GO:0003677; GO:0003918; GO:0005524; GO:0005694; GO:0006265; GO:0007059
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the type II topoisomerase family. ParE type 2 subfamily. {ECO:0000256|HAMAP-Rule:MF_00939}.; SIMILARITY: Contains 1 Toprim domain. {ECO:0000256|HAMAP-Rule:MF_00939}.
Protein families: Type II topoisomerase family, ParE type 2 subfamily
Coiled coil: 
Domain [FT]: DOMAIN 424 538 Toprim. {ECO:0000259|PROSITE:PS50880}.
Motif: 
Region: 
EMBL: AGBZ02000002
ProteinModelPortal: A0A037UKM7
MEROPS: 
EnsemblBacteria KO: KAI92484
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.30.230.10;3.30.565.10;3.40.50.670
InterPro: MF_00939
PANTHER: IPR002288;IPR003594;IPR005740;IPR020568;IPR014721;IPR001241;IPR013760;IPR013506;IPR013759;IPR018522;IPR006171
PIRSF: 
PRINTS: 
PROSITE: PR00418
Pfam: PS00177;PS50880
ProDom: PF00204;PF00986;PF02518;PF01751
SMART: 
SUPFAM: SM00387;SM00433
TIGRFAMs: SSF54211;SSF55874;SSF56719
40237-42175(-)

>nucleotide sequence
TTAATTAATGATTGCTTGAAAATCATCTTCTAAAGTAAACTTAACATTTTCATCAATTCA
ATCTTTTCGTTTTTTAGCATCATCTCCCATTAAGGTTACAATCCGTCTTTCAGCCATAAC
GGCATCATCAATTGTTACTAAAATTAATTGACGAGTTTGAGGATTCATTGTTGTTTCTCA
TAATTGTTCTGCATTCATTTCTCCTAACCCTTTATAACGTTGTAATTCAAATTTACCATG
AAATTGACTTAATTTATTTTTTAATTCTGTTTCATCTCATGCATATTCAATATGTTTATT
TTTGGTGCTAGTAATCTTAAATAAAGGTGGCAAAGCAAGATAAACACGATGATTTTCAAT
TAATGGTCGCATATAACGATAAAAAAATGTTAATAGTAAAGTTTGAATATGTGCCCCATC
AGTATCTGCATCGGTCATAATAATTACTTTACCATAGTTGGCATCATTAATGTCAAAACC
ATTTCCCACTCCTGCACCAATGGCATTAATCATTACATTAATTTCTTCATTATTCATTAA
ATCTTGAAGTTTTGCTTTTTCAGCATTAATTACTTTCCCTCGTAATGGTAAAATTGCTTG
AAAACGACGATCACGTCCTAATTTGGCACTTCCCCCAGCAGAATCTCCTTCAACTAAAAA
AATCTCATTATTAAATTTATTTCGATTTTGAGCAGGGGTTAATTTTCCTGTTAATAAACG
ATCACTATTACCCCGTTTTTTGCTATTGCGCGCTGCTTCACGTGCTTTCCGAGCTTCTTC
ACAAACATTACGAGCTAATAATGCTTTTTCAATAATAGTGTAAGCATTTGTTTTATTTTC
TGTTAATCAAAATCCAAATTGTTTTGCTACAATCGTTTCAACTGCAACCCGAGCTTCATA
AGTTCCTAATTTTCCTTTGGTTTGTCCTTCATATTGAATTAAATTTTCAGGAATTTTCAC
TGAAACAATAGCCGTTAGTCCTTCACGTGTATCAACTGAATCAAGATTTTTATCTTTTTC
TTTTAACAATCCTTCTTTCCGAGCATAATCATTAATTACTTTTGTTAATCCTGTTCGGAA
TCCAACAACATGGCTACCACCTTCGCTTGTTTTAACATTATTTGCAAAACTAAGTAAATT
TTCATTAAATTCAGTTGAATATTGTAATGCTATTTCAACTTCGATTTGTTTTTCTACTCC
TTTTAACATAATAATTGGAGTAATACTTTTTTTATCTTCATTCATATAAGTAATGAACTC
TTCTAAACCATTATTAAATAAATATGATACTTTTTTATCAGTTCGTTGGTCAGTCAATGT
TAACTTAACCCCGCTATTTAAAAATGCTGATTCACGAATTCGTTCTGAAATTGTTGAAAA
AGAAAAATCAATTACTTTAAAAATCTTATGATCAGGTAAAAAAGTAACTGTTGTTCCCGT
TTTCGTTGTTGTTCCAATTTTTGTTAATGGTTCTTTAACTTGACCACCATTTGCGAATTT
AATACTTCAAACTTTATGATCACGATAAATTGTGACATCAAAAGTGGCCGATAAAGCGTT
AACAACTGAAGAACCAACACCATGTAGTCCGCCTGCTGTTTTATAACCATCACCACCAAA
TTTTCCACCAGCATGTAAAACTGAAAAAATTACTTCTGGGGTTGATTTTCCAGATGAATG
AATTCCAGTTGGAACACCACGCCCATTATCTGCCACCATAATAGCATTATTCTTATAAAT
AATAATATCAATTTCATTACAATAACCAGCTAATGCCTCATCAATTGAATTATCAATAAT
TTCTCAAACTAAATGATGTAATCCACGAACATCAGTTGACCCAATATACATTCCTGGACG
TTTTCGAACTGCATCTAGTCCTTCTAAAATCTGAATTGATGATTCATCATACTTTAATGT
TTTATCTTCAATACTCAT


>protein sequence
MSIEDKTLKYDESSIQILEGLDAVRKRPGMYIGSTDVRGLHHLVWEIIDNSIDEALAGYC
NEIDIIIYKNNAIMVADNGRGVPTGIHSSGKSTPEVIFSVLHAGGKFGGDGYKTAGGLHG
VGSSVVNALSATFDVTIYRDHKVWSIKFANGGQVKEPLTKIGTTTKTGTTVTFLPDHKIF
KVIDFSFSTISERIRESAFLNSGVKLTLTDQRTDKKVSYLFNNGLEEFITYMNEDKKSIT
PIIMLKGVEKQIEVEIALQYSTEFNENLLSFANNVKTSEGGSHVVGFRTGLTKVINDYAR
KEGLLKEKDKNLDSVDTREGLTAIVSVKIPENLIQYEGQTKGKLGTYEARVAVETIVAKQ
FGFWLTENKTNAYTIIEKALLARNVCEEARKAREAARNSKKRGNSDRLLTGKLTPAQNRN
KFNNEIFLVEGDSAGGSAKLGRDRRFQAILPLRGKVINAEKAKLQDLMNNEEINVMINAI
GAGVGNGFDINDANYGKVIIMTDADTDGAHIQTLLLTFFYRYMRPLIENHRVYLALPPLF
KITSTKNKHIEYAWDETELKNKLSQFHGKFELQRYKGLGEMNAEQLWETTMNPQTRQLIL
VTIDDAVMAERRIVTLMGDDAKKRKDWIDENVKFTLEDDFQAIIN






















© Fisunov Lab of Proteomics, 2016.