SPM_004115


  Uniprot: A0A037URY6
Description: membrane protein
EC number: 
Annotation score: 3 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: Acyl-phosphate + sn-glycerol 3-phosphate = 1-acyl-sn-glycerol 3-phosphate + phosphate. {ECO:0000256|HAMAP-Rule:MF_01043}.
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP. {ECO:0000256|HAMAP-Rule:MF_01043}.
Pathway: PATHWAY: Lipid metabolism; phospholipid metabolism. {ECO:0000256|HAMAP-Rule:MF_01043, ECO:0000256|SAAS:SAAS00573208}.
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): plsY
Gene names (synonym): 
Mass: 29,988
Subunit structure [CC]: SUBUNIT: Probably interacts with PlsX. {ECO:0000256|HAMAP-Rule:MF_01043, ECO:0000256|SAAS:SAAS00573198}.
Gene ontology (GO): integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; acyl-phosphate glycerol-3-phosphate acyltransferase activity [GO:0043772]; phospholipid biosynthetic process [GO:0008654]
Gene ontology IDs: GO:0005886; GO:0008654; GO:0016021; GO:0043772
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the PlsY family. {ECO:0000256|HAMAP-Rule:MF_01043, ECO:0000256|SAAS:SAAS00573209}.
Protein families: PlsY family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: AGBZ02000002
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92485
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 
InterPro: MF_01043
PANTHER: IPR003811
PIRSF: PTHR30309:SF0
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF02660
SMART: 
SUPFAM: SM01207
TIGRFAMs: 
42299-43091(+)

>nucleotide sequence
ATGACATTATATGGATATTTAGGAACAGCTATTACAGCAATAATTGGATACTTAATTGGT
TCTTTTAGTTGGTCAATTTTTATTAGTAAAAAAATTTATAAAATTGATGTGCGTGATTAT
CATTCTAAAAATGCCGGAGCCACAAATACTAGTCGTGTTTTAGGAAAAAAATGAGGTTTT
GCCATCATGTTTTTAGATATGCTAAAAGTTACTATTACAATGTTTATTGCCTTTGGTATT
AGTTGTATTAATATTAATGGTGTTAATTTTGGTTCAACTAGTTATTATATTCCAGCTTTT
TTTGTTTTAATTGGTCATTCTTATCCAATTTATTATAAATTTAAAGGTGGAAAAACAGTT
TCGTCTTTTTTAGGTTTATTATGAATGACTAATCCATATTATTTTTTAATTGCTACAGTT
GTTTGATGAAGTACAATTTTTATTTGAAAACGAGTTTCTGTTTCTTCAATTTTAGCAGCA
CTATTTACAGGAGCATTATGTTGAATCCCACAATTAAGTGGCATTGATATTATCAATTTT
AATGGTGATTTACTTCAAAATTCTCACCTTGTTTGAGTGAATTACTTACATTATGTTAAT
TATGATAATTACTACGATAGTTTAGCTTTAATTAATATTATTATTACTTTAAGTGCTATT
TTCTTAATCTTAAAACATCATCAAAATATTACTCGTTTATTAAAAGGAACCGAAAAGCCT
TATGATTTTAAAGGGAAATCTGATTTAGAAAATGGTAATCTTTCAAAACACAATAAAATA
AAAAAACACTAA


>protein sequence
MTLYGYLGTAITAIIGYLIGSFSWSIFISKKIYKIDVRDYHSKNAGATNTSRVLGKKWGF
AIMFLDMLKVTITMFIAFGISCININGVNFGSTSYYIPAFFVLIGHSYPIYYKFKGGKTV
SSFLGLLWMTNPYYFLIATVVWWSTIFIWKRVSVSSILAALFTGALCWIPQLSGIDIINF
NGDLLQNSHLVWVNYLHYVNYDNYYDSLALINIIITLSAIFLILKHHQNITRLLKGTEKP
YDFKGKSDLENGNLSKHNKIKKH






















© Fisunov Lab of Proteomics, 2016.