SPM_004330


  Uniprot: A0A037UP97
Description: thioredoxin reductase
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 34,053
Subunit structure [CC]: 
Gene ontology (GO): cytoplasm [GO:0005737]; thioredoxin-disulfide reductase activity [GO:0004791]; removal of superoxide radicals [GO:0019430]
Gene ontology IDs: GO:0004791; GO:0005737; GO:0019430
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 9 298 FAD/NAD-binding_dom. {ECO:0000259|Pfam:PF07992}.
Motif: 
Region: 
EMBL: AGBZ02000003
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92401
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.50.50.60
InterPro: 
PANTHER: IPR023753;IPR000103;IPR005982
PIRSF: 
PRINTS: 
PROSITE: PR00469
Pfam: 
ProDom: PF07992
SMART: 
SUPFAM: 
TIGRFAMs: SSF51905
22612-23554(-)

>nucleotide sequence
TTAATGACAACTATCAAGATATTCTAGCGCAAATTGAGCTGCTTTTGCCCCATCACTAAT
TGCAGTTGCAATTTGTCGTAATGTTGTATTTGTTACATCACCAGCGGCATATAATCCAGG
CAATACTGTTAAACATTTATTATTAACAACAAAATAACCTTCTTCATCTAAAACCCCTAA
GTTTTTTGCAAAATCACTAATTGGAATCGCCCCAATATATGTGAAAATAGCACTAACTGC
TAAATTATCAATTTTGCTTGTTTTCACATTTTTAATAACAACTGTTGTCACTCGTTTTTC
GGTCACATCCTTAATTTCAGTTACTATTGTATCAATAATAAAATTAATTTTAGGATGTGC
TTTTACTTTATTAACAATATTATGATCAGCACGAAATTCAGCACGACGATGAATTAAATA
AACTTTATTGACAAAACGAGCTAAATAAAGGGCTTCTTCCAGAGCAGCGTAGCCTCCCCC
AACAACAACTACATCTTTTCCTTTATATAATGCCCCATCACAAACCGCACAGTATGAAAC
TCCATGTCCTTCTAATTCTAATTCGCCAGGCACTCCTAATTTTCGTTCAACTGTACCAGT
TGCAACAATAACAGCTTTTGCTAATAAAAATTTTTTTGAAAATAACTCTAATTTAAATAA
ATTATCTTGTTTTGTAATGGTTGTTACACGATCGGCAATATATGGAATTTTTAATTTTTG
CGTTTGGTCAAACATTTTCATTGCTAATTCATAACCTTGAATGCTATCAAAACCAGGATA
ATTTTCAATTTCACTTGTCTTTGTTACTTTTCCCCCGGGTGCTCCTTTTTCAATCATTGC
AATATTTGCCATTGCTCGTGCAGCATAAATTGCTGCCGTCATGCCACCAGGACCAGCCCC
AATAATTAAAATATCATATATTTCATTAGTATTGTTTTTCAT


>protein sequence
MKNNTNEIYDILIIGAGPGGMTAAIYAARAMANIAMIEKGAPGGKVTKTSEIENYPGFDS
IQGYELAMKMFDQTQKLKIPYIADRVTTITKQDNLFKLELFSKKFLLAKAVIVATGTVER
KLGVPGELELEGHGVSYCAVCDGALYKGKDVVVVGGGYAALEEALYLARFVNKVYLIHRR
AEFRADHNIVNKVKAHPKINFIIDTIVTEIKDVTEKRVTTVVIKNVKTSKIDNLAVSAIF
TYIGAIPISDFAKNLGVLDEEGYFVVNNKCLTVLPGLYAAGDVTNTTLRQIATAISDGAK
AAQFALEYLDSCH






















© Fisunov Lab of Proteomics, 2016.