SPM_004340


  Uniprot: A0A037UP64
Description: serine kinase
EC number: 2.7.11.-; 2.7.4.-
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: ATP + HPr = ADP + P-Ser-HPr. {ECO:0000256|SAAS:SAAS00281214}.; CATALYTIC ACTIVITY: P-Ser-HPr + phosphate = HPr + diphosphate. {ECO:0000256|SAAS:SAAS00281211}.
Cofactor: COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000256|SAAS:SAAS00281221};
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 35,091
Subunit structure [CC]: SUBUNIT: Homohexamer. {ECO:0000256|SAAS:SAAS00281210}.
Gene ontology (GO): intracellular [GO:0005622]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; phosphorelay sensor kinase activity [GO:0000155]; protein serine/threonine kinase activity [GO:0004674]; regulation of carbohydrate metabolic process [GO:0006109]
Gene ontology IDs: GO:0000155; GO:0004674; GO:0005524; GO:0005622; GO:0006109; GO:0046872
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the HPrK/P family. {ECO:0000256|SAAS:SAAS00535415}.
Protein families: HPrK/P family
Coiled coil: 
Domain [FT]: DOMAIN 6 127 Hpr_kinase_N. {ECO:0000259|Pfam:PF02603}.; DOMAIN 132 301 Hpr_kinase_C. {ECO:0000259|Pfam:PF07475}.
Motif: 
Region: 
EMBL: AGBZ02000003
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92403
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.40.1390.20;3.40.50.300
InterPro: 
PANTHER: IPR003755;IPR011104;IPR011126;IPR027417;IPR028979
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF07475;PF02603
SMART: 
SUPFAM: 
TIGRFAMs: SSF75138
24764-25688(-)

>nucleotide sequence
CTATTTTGAATATTCTTTAAAACGATCTTGTAAAATTTGCATTGAAGAAATTCCCGCTTC
ATCTAATTTTAATTTTGAAACTGCTGTCTCAACTAATTCACTAACATTACGCCCATATGT
AACTGGAATTGTTACAATTGGTACTTTTGTATCTAAAATTTTAATATTCTTATATTTACT
TCCTAATCGGTCAATTGATTTATATTGTTCATCATCTAAATGAATTAATTCAATTACTAA
ATCAATTTTTGATTCATCTAATAGCACTTGTAAACCATAAATTTTACTTAAATCTAAAAT
TCCTAAACCGCGAACCTCAATTAAATTTTTTAACATTTCATGGGATTGGCCATATAACCT
ATTATTTCGTTGCTGAACAATAATACGATCATCACCAACAAACAAATGATTTTTTTTAAT
TAATTCTAGTGTCATTTCTGACTTCCCAATTCCCGATTTTCCTTTTAATAAAATTCCTTT
TCCAAAAACATTAATTAATGATGCATGTTCTTCTGTTACTGGTGCAAAATGCTCATCAAA
AAATTCTAATACCATTTGATATAAACGACTTGTTGTAATATTGCTTGCACGAACAACTGG
ACAACTATGTTTTTCCGCAATTTCTAATAATAATTTATCAGTAAATTTTTCCGTTAAAAT
AATCATCGGAATGTTTTCATTTAAAATATACTCATAGCGTTCTCTTTTTACTGTTTCACT
TAAGGTATTCACAAATAACTGCTCTTTATTTGATAACAAAACTACCCGACGATTACTATT
ATTTTTTTCAAAATCAAAACCAGCTAATTCTAACCCTGGTCGATTAAGACCATAAATTTT
AATAGGTCGATTAAGACCATCGGCTCCAGCTAAAACCTCATAGCCAAATTTATCAACAAT
ATCTTTTACAATAAATTTTGTCAT


>protein sequence
MTKFIVKDIVDKFGYEVLAGADGLNRPIKIYGLNRPGLELAGFDFEKNNSNRRVVLLSNK
EQLFVNTLSETVKRERYEYILNENIPMIILTEKFTDKLLLEIAEKHSCPVVRASNITTSR
LYQMVLEFFDEHFAPVTEEHASLINVFGKGILLKGKSGIGKSEMTLELIKKNHLFVGDDR
IIVQQRNNRLYGQSHEMLKNLIEVRGLGILDLSKIYGLQVLLDESKIDLVIELIHLDDEQ
YKSIDRLGSKYKNIKILDTKVPIVTIPVTYGRNVSELVETAVSKLKLDEAGISSMQILQD
RFKEYSK






















© Fisunov Lab of Proteomics, 2016.