SPM_004485
  | Uniprot: A0A037UKH4
Description: single-stranded DNA-binding protein EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a "tag peptide", a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the "tag peptide" encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation. {ECO:0000256|HAMAP-Rule:MF_00023}.; FUNCTION: Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation. {ECO:0000256|SAAS:SAAS00308991}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): smpB Gene names (synonym): Mass: 17,005 Subunit structure [CC]: Gene ontology (GO): cytoplasm [GO:0005737]; DNA binding [GO:0003677]; RNA binding [GO:0003723]; trans-translation [GO:0070929] Gene ontology IDs: GO:0003677; GO:0003723; GO:0005737; GO:0070929 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the SmpB family. {ECO:0000256|HAMAP-Rule:MF_00023, ECO:0000256|SAAS:SAAS00543763}. Protein families: SmpB family Coiled coil: Domain [FT]: Motif: Region: EMBL: AGBZ02000003 ProteinModelPortal: MEROPS: EnsemblBacteria KO: KAI92429 UniPathway: CDD: Gene3D: cd09294 HAMAP: 2.40.280.10 InterPro: MF_00023 PANTHER: IPR023620;IPR000037;IPR020081 PIRSF: PRINTS: PROSITE: Pfam: PS01317 ProDom: PF01668 SMART: PD004488 SUPFAM: TIGRFAMs: SSF74982 |
57130-57562(-) >nucleotide sequence ATTCTTTTTCCCACGAACTAAAGCAATTTCTAATTTAGCATAATTATTTTTAAGATATAA CTTTAACGGTACTAACGTTAAACGTTCTAATTTAATTCGTTGCAAAATTTTCTTAATTTC TTTTTTATGTAAAAGCAATTTTCTAGTACGGTCAGCATCTGGCACGTATGCTGTTGAAAA TTTATATTGAGCAATTATCATATTAATAACAAACGCCTCATTTTTACGAATAATAACAAA CGCCTCATTAATTGATACATCATTATTCCGAATTGACTTAATCTCACTGCCTGTCAAAAC AATGCCAGCTTCATAGGTTTCAATAATTTCATAATTATACCGTGCTTTTTTATTAACTGT AATTGTCAACAT >protein sequence AQYKFSTAYVPDADRTRKLLLHKKEIKKILQRIKLERLTLVPLKLYLKNNYAKLEIALVR GKKNYDKRETIKQRDNERLRRKY |
© Fisunov Lab of Proteomics, 2016.