SPM_004490


  Uniprot: A0A037URU0
Description: ribonuclease R
EC number: 3.1.13.1
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: Exonucleolytic cleavage in the 3'- to 5'-direction to yield nucleoside 5'-phosphates. {ECO:0000256|HAMAP-Rule:MF_01895, ECO:0000256|SAAS:SAAS00089937}.
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: 3'-5' exoribonuclease that releases 5'-nucleoside monophosphates and is involved in maturation of structured RNAs. {ECO:0000256|HAMAP-Rule:MF_01895}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): rnr
Gene names (synonym): 
Mass: 81,678
Subunit structure [CC]: 
Gene ontology (GO): cytoplasm [GO:0005737]; exoribonuclease II activity [GO:0008859]; RNA binding [GO:0003723]
Gene ontology IDs: GO:0003723; GO:0005737; GO:0008859
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the RNR ribonuclease family. RNase R subfamily. {ECO:0000256|HAMAP-Rule:MF_01895}.; SIMILARITY: Contains 1 S1 motif domain. {ECO:0000256|HAMAP-Rule:MF_01895}.
Protein families: RNR ribonuclease family, RNase R subfamily
Coiled coil: 
Domain [FT]: DOMAIN 624 704 S1 motif. {ECO:0000259|PROSITE:PS50126}.
Motif: 
Region: 
EMBL: AGBZ02000003
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92430
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 2.40.50.140
InterPro: MF_01895
PANTHER: IPR012340;IPR013223;IPR022966;IPR004476;IPR011805;IPR022967;IPR003029
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS01175;PS50126
ProDom: PF08206;PF00575
SMART: 
SUPFAM: SM00316
TIGRFAMs: SSF50249
57575-59693(-)

>nucleotide sequence
TTAATCAACTAGTTCAAAATCAATTTGTCGTAGTTTTTTACTTGCTTTCTTTACTCTAAT
TCGTACTTTTTTTCCTAAAAAATATTCTTTCCGTTTTCGTTCTCCAATTAATTTTAAACT
TTTTTCATCAAAAACGTAATAGTCATTTTTTAAATCAGTAATATGAACCAATCCTTCAAT
TGTATTTGGTAATTCAACAAAAATTCCAAACGAAGTAACCCCTGCAATAATACCATTATA
TTCATATCCAATTTTATCTTCCATATATTCGGCTTCTTTCATTTTATCAACTTCTCGTTC
ACATTCCATTGCCCGTAATTCTGCAAGGGATGACTGTTGACTAGCATGACTAACAAAAGC
TCGCGTTTGTTCTAAATCAGTAATTTTAACTTTTCCTTGAAATAAATACTCTTTTAATAA
ACGATGAACAACTAAATCGGGATAGCGCCGAATTGGCGAAGTAAAGTGCGTATAACATCA
AGATGCCAAACCAAAATGACCATCATTAATAGCACTATACTTAGCTTTTTCCATACTTCG
TAACACTAACGCTGAAATAACTTTAAAATTTTCCTTATCCTTTAACTTATTTAAAATTTG
CTGTAAATCTTTAGAATGAATATTTTCTAACTTACCTTTAATATTTAAACCTAAATAAGA
TAATTGGGTATACAAGTCAAACAATTTTTTTGGCTTTGGCTTATCATGGACTCGATAAAC
AAATGGTAAATCCATTCAATAAATTGTTTCTGCTACTGTTTCATTAGCACGAATCATAAA
ACTCTCAATTAATTTTTCCGCGTCAGCACGTTCTCGTACAACAATGTCTTTAATCTTACC
ATTTTTATCAACAATAAACTTTGGTTCATCTAAATCAAAATCAACAACCCCATCATGTTC
TTTTTTTCAAACTAAAATTTGATATAACTGTTGCGCTAAAAACAACATCTGAGCAATTTC
GGCTGAAATATGATTTTTTTCCTGGCAAAATAATTTATTAACCTCATCATAAGTTAATCG
CGCTTTTGAAATAATCACGGCTTCATAAATACTAGAATTAACAACATGTCCCTGCTGATC
AATTTCCATTTCACAAATTAATGTTAATCGTGGCTCAAAAGGATTTAAGGAACAAATCCC
ATTACTTAATTTTTCTGGTAACATTGGGACAACCCGATCAATTAAATAAACTGAACACCC
TCGTTCAAAAGCTTCTTTATCAAGATAACTATTATGTGGAACATAATGCGCAACATCAGC
AATTGAAACTAATAATAAATAATTACCATTTTGATTTTTTTTAACTAAAATAGCATCATC
AAAATCTTTTGAATCATTACCATCAATTGTAACAAACATTTCTGTTTGTAAATCACGGCG
TGATTTATTTGCCAACATCGTTGCAACATCAACATTTTGGTTAATTTGGTTCGCCTCAGT
TAATGCCTCTTCATTAAATTTAGTACGAATATTAAATTCATGTAAAATAGCTAAAACATC
AACACCGACTTGATTAGTATTACCAATAATCTCAATGATTTTAACTTGCATTAAATTGTT
TTTACTATTAATACTTGTAATAATTCCCTTGACAATTGTATTTTCAATTGCCTCAGCCAA
ATTAATGATTTCAGCACGATATTGGGTTAATTTATTATTTAAAATTTCTAAATATTTCTG
TTGATGACGATTCTTTTTAATAACCCCAACGACATATTCATTATTTCGTTTCAAAACTTT
AATTACTTGTGCTTCTGCTTTTTTAGAATTATTATCATTTTTTTGTTTTTTTAAAATAAA
CAAAACTTGATCTTGGTCTAAGGCATTATTTAAATCATCTTGTTTAACATAATATTCTTC
TTGGTTTTCATTAATTTTTATAAAACCAAAACCTTTTTTATTAATACTAATAACTCCTCG
TAAATAAATTTTTGGATCAAAATAGTAAAAACGATGTTGTTGTGTTACTCCAATAATATT
ATCATTTTCTAATTCAACTAAAGCCTTTAACAACATTTTATTATCATCAATTTTATTAAT
ATTTAATAACTGTGCTAATTCAATCGTATCAATTAGTTTCGTTTGTTTTTTTAAAATGGC
TACAATTTGCTCGTGCAT


>protein sequence
MHEQIVAILKKQTKLIDTIELAQLLNINKIDDNKMLLKALVELENDNIIGVTQQHRFYYF
DPKIYLRGVISINKKGFGFIKINENQEEYYVKQDDLNNALDQDQVLFILKKQKNDNNSKK
AEAQVIKVLKRNNEYVVGVIKKNRHQQKYLEILNNKLTQYRAEIINLAEAIENTIVKGII
TSINSKNNLMQVKIIEIIGNTNQVGVDVLAILHEFNIRTKFNEEALTEANQINQNVDVAT
MLANKSRRDLQTEMFVTIDGNDSKDFDDAILVKKNQNGNYLLLVSIADVAHYVPHNSYLD
KEAFERGCSVYLIDRVVPMLPEKLSNGICSLNPFEPRLTLICEMEIDQQGHVVNSSIYEA
VIISKARLTYDEVNKLFCQEKNHISAEIAQMLFLAQQLYQILVWKKEHDGVVDFDLDEPK
FIVDKNGKIKDIVVRERADAEKLIESFMIRANETVAETIYWMDLPFVYRVHDKPKPKKLF
DLYTQLSYLGLNIKGKLENIHSKDLQQILNKLKDKENFKVISALVLRSMEKAKYSAINDG
HFGLASWCYTHFTSPIRRYPDLVVHRLLKEYLFQGKVKITDLEQTRAFVSHASQQSSLAE
LRAMECEREVDKMKEAEYMEDKIGYEYNGIIAGVTSFGIFVELPNTIEGLVHITDLKNDY
YVFDEKSLKLIGERKRKEYFLGKKVRIRVKKASKKLRQIDFELVD






















© Fisunov Lab of Proteomics, 2016.