SPM_004545
  | Uniprot: A0A037URV0
Description: ATP synthase subunit C EC number: Annotation score: 1 out of 5 Miscellaneous [CC]: Protein existence: Predicted Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): Gene names (synonym): Mass: 10,354 Subunit structure [CC]: SUBUNIT: F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. {ECO:0000256|SAAS:SAAS00499075}. Gene ontology (GO): integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; proton-transporting ATP synthase complex, coupling factor F(o) [GO:0045263]; hydrogen ion transmembrane transporter activity [GO:0015078]; ATP hydrolysis coupled proton transport [GO:0015991]; ATP synthesis coupled proton transport [GO:0015986] Gene ontology IDs: GO:0005886; GO:0015078; GO:0015986; GO:0015991; GO:0016021; GO:0045263 Chain: Signal peptide: Domain [CC]: Sequence similarities: Protein families: Coiled coil: Domain [FT]: DOMAIN 33 95 ATP-synt_C. {ECO:0000259|Pfam:PF00137}. Motif: Region: EMBL: AGBZ02000003 ProteinModelPortal: MEROPS: EnsemblBacteria KO: KAI92440 UniPathway: CDD: Gene3D: HAMAP: 1.20.20.10 InterPro: PANTHER: IPR000454;IPR005953;IPR020537;IPR002379 PIRSF: PRINTS: PROSITE: PR00124 Pfam: PS00605 ProDom: PF00137 SMART: SUPFAM: TIGRFAMs: SSF81333 |
67252-67555(-) >nucleotide sequence AGTAATGGCAGCAGCAATAATATATTGTGTTCGAACTTTACTTTCAACTTCTGGATTTCG AGCAATTGCTTCAACAGCTTTTCCACCAGTATACCCTTGTCCAATTCCTGAACCACAACA ACCAATGGCAGCTAATCCTGCTCCCAATAATGACATTCCCTTTGTAAATCCATCATTAAT TCCAGCCATGAATCATATTGTCATCATATTTGATAGCAAATCTATTGTCATAAAATTTAT CAT >protein sequence ARNPEVESKVRTQYIIAAAITESGSIYALVIAIILAFVTG |
© Fisunov Lab of Proteomics, 2016.