SPM_004735


  Uniprot: A0A037UN54
Description: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
EC number: 4.6.1.12
Annotation score: 3 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: 2-phospho-4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol = 2-C-methyl-D-erythritol 2,4-cyclodiphosphate + CMP. {ECO:0000256|HAMAP-Rule:MF_00107, ECO:0000256|RuleBase:RU004395, ECO:0000256|SAAS:SAAS00096238}.
Cofactor: COFACTOR: Name=a divalent metal cation; Xref=ChEBI:CHEBI:60240; Evidence={ECO:0000256|HAMAP-Rule:MF_00107}; ; Note=Binds 1 divalent metal cation per subunit. {ECO:0000256|HAMAP-Rule:MF_00107}
Enzyme regulation: 
Function [CC]: FUNCTION: Involved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP). {ECO:0000256|HAMAP-Rule:MF_00107}.
Pathway: PATHWAY: Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via DXP pathway; isopentenyl diphosphate from 1-deoxy-D-xylulose 5-phosphate: step 4/6. {ECO:0000256|HAMAP-Rule:MF_00107, ECO:0000256|SAAS:SAAS00096241}.
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: METAL 9 9 Divalent metal cation. {ECO:0000256|HAMAP-Rule:MF_00107}.; METAL 11 11 Divalent metal cation. {ECO:0000256|HAMAP-Rule:MF_00107}.; METAL 43 43 Divalent metal cation. {ECO:0000256|HAMAP-Rule:MF_00107}.
Nucleotide binding: 
Site: SITE 131 131 Transition state stabilizer. {ECO:0000256|HAMAP-Rule:MF_00107}.
Gene names (primary): ispF
Gene names (synonym): 
Mass: 17,186
Subunit structure [CC]: SUBUNIT: Homotrimer. {ECO:0000256|HAMAP-Rule:MF_00107, ECO:0000256|SAAS:SAAS00248098}.
Gene ontology (GO): 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity [GO:0008685]; metal ion binding [GO:0046872]; isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288]; terpenoid biosynthetic process [GO:0016114]
Gene ontology IDs: GO:0008685; GO:0016114; GO:0019288; GO:0046872
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the IspF family. {ECO:0000256|HAMAP-Rule:MF_00107, ECO:0000256|RuleBase:RU004395, ECO:0000256|SAAS:SAAS00574101}.
Protein families: IspF family
Coiled coil: 
Domain [FT]: DOMAIN 2 134 YgbB. {ECO:0000259|Pfam:PF02542}.
Motif: 
Region: REGION 9 11 Substrate binding. {ECO:0000256|HAMAP-Rule:MF_00107}.; REGION 57 59 Substrate binding. {ECO:0000256|HAMAP-Rule:MF_00107}.; REGION 129 133 Substrate binding. {ECO:0000256|HAMAP-Rule:MF_00107}.
EMBL: AGBZ02000004
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92046
UniPathway: 
CDD: 
Gene3D: cd00554
HAMAP: 3.30.1330.50
InterPro: MF_00107
PANTHER: IPR003526
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF02542
SMART: 
SUPFAM: 
TIGRFAMs: SSF69765
15760-16222(+)

>nucleotide sequence
ATAATGCGAGTTGGCAATAGTTATGATTTACATAATTTAAAAATGGGAACAGGTTTTTAT
TTGGGGGGAATTCTTATTCCATGCCAATACCAAGTTGAAGCTGTTTCTGATGGTGATATT
TTGTTGCATACAATTAGTGAAGCAATTATTGGAGCCTTAGGATTGGGTGATTTAGGTGAA
TGATTTGATGAAACAAATAAAAAACTTAATTCACAGTTAATTTTAAAAAAAGCATTAACA
TTAATGGCTGAGCAGAATTATCAAATTAGTAATATTGATACAACAATTATTATTGATGAA
CCACGTTTACAAAAACATAAAAAAGCAATTAAAACTAATTTACAAAAATTATTACAAATT
CCAGCTGAAAAAATTAATTTAAAAGCAACAACTACTGAACAAAATTTTCCAAATATTATT
CAAAGTTATACAACATTATTACTATTAAAAGAAAATGATTAG


>protein sequence
IMRVGNSYDLHNLKMGTGFYLGGILIPCQYQVEAVSDGDILLHTISEAIIGALGLGDLGE
WFDETNKKLNSQLILKKALTLMAEQNYQISNIDTTIIIDEPRLQKHKKAIKTNLQKLLQI
PAEKINLKATTTEQNFPNIIQSYTTLLLLKEND






















© Fisunov Lab of Proteomics, 2016.