SPM_004950
  | Uniprot: A0A037UKR8
Description: 50S ribosomal protein L22 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome. {ECO:0000256|HAMAP-Rule:MF_01331}.; FUNCTION: This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g., L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome. {ECO:0000256|HAMAP-Rule:MF_01331, ECO:0000256|RuleBase:RU004008}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rplV Gene names (synonym): Mass: 12,572 Subunit structure [CC]: SUBUNIT: Part of the 50S ribosomal subunit. {ECO:0000256|HAMAP-Rule:MF_01331, ECO:0000256|RuleBase:RU004006}. Gene ontology (GO): large ribosomal subunit [GO:0015934]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] Gene ontology IDs: GO:0003735; GO:0006412; GO:0015934; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L22P family. {ECO:0000256|HAMAP-Rule:MF_01331, ECO:0000256|RuleBase:RU004005}. Protein families: Ribosomal protein L22P family Coiled coil: Domain [FT]: Motif: Region: EMBL: AGBZ02000004 ProteinModelPortal: A0A037UKR8 MEROPS: EnsemblBacteria KO: KAI92087 UniPathway: CDD: Gene3D: cd00336 HAMAP: 3.90.470.10 InterPro: MF_01331_B PANTHER: IPR001063;IPR018260;IPR005727 PIRSF: PTHR13501 PRINTS: PROSITE: Pfam: PS00464 ProDom: PF00237 SMART: SUPFAM: TIGRFAMs: SSF54843 |
60370-60709(+) >nucleotide sequence ACCGATTTAATTCGGAATAAAAAAGTGGGAGACGCAATAGTTATTCTTAACAACACAAAC AAAAAATCATCAGTTCCAGTTCAAAAATTAGTTAAATCAGCGGTAGCAAATGCCGTTAAT AATAATGGATTGGATGCTGATCGCTTATTTATTAAAGAAATCTTCGTTAACGAAGGACCA ACATTAAAACGTTTCCGTCCGCGTGCACATGGACGAGCATATGAAATATTGAAGAGAACA AGTCATATCACAGTTACTGTTAGTGATGGGCAACAATAA >protein sequence NNGLDADRLFIKEIFVNEGPTLKRFRPRAHGRAYEILKRTSHITVTVSDGQQ |
© Fisunov Lab of Proteomics, 2016.