SPM_004965


  Uniprot: A0A037UQT2
Description: 50S ribosomal protein L29
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 36,580
Subunit structure [CC]: 
Gene ontology (GO): ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]
Gene ontology IDs: GO:0003735; GO:0005840; GO:0006412
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L29P family. {ECO:0000256|SAAS:SAAS00546669}.
Protein families: Ribosomal protein L29P family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: AGBZ02000004
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92090
UniPathway: 
CDD: 
Gene3D: cd00427
HAMAP: 1.10.287.310
InterPro: MF_00374
PANTHER: IPR001854;IPR018254
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS00579
ProDom: PF00831
SMART: 
SUPFAM: 
TIGRFAMs: SSF46561
61903-62923(+)

>nucleotide sequence
ATGAATGATTTAACCAAAAAATCAGTTGAAGAATTGAAAAAACTGGAAGAAGAATCACGT
GCTGAATTATTTGCGTTACGATTCCAATCAGCAATGGGGAATTTAGAAAAACCACATCGC
ATTGGGGAATTAAAAAAGCAAATTGCTCGCATTTTAACAATCTTATCTGCTCGTAAAAAT
GCTGGGGAAAATACGGCAATTAATGTTAAAGTTAATTTAAATGAAACATATGCGAAAATT
GAAAAAGAATCACAAGCATTTGCAAAACAACGCAAGGCAAAAATTGAACAAATGATGGCT
GAGCAACAAGCTGCTGAAGGAAAAATGGCAAATTTAATGGATTTACCATTAAATGATGCA
ATGGATTTAACAGAAGAACAAGCTGTTGCTTCAACACCAATAGGAGAAACAAATGGTCTT
GATGAACAAAAAGCACCAGTTGCTGCAAAGAAACCAGCTGCTGCTAAAGATTCTCCTAAG
CAAAAAGATGTTGCGGAAGAAAAAACTGCAACTGGAAAAGCAGCCACACCATCTGCTAAA
AAAGCACCAGTGGCTAAAAAAGATGTTGCACAAGAAACTAAAACTGATAAGGATGCAGCA
TTAAAAGCTTTAATTAAAGAAAAAGCTGCGGAAAAGAAACCAACCGCAAAAAGTAAAACA
TCAACACCAAGCGACAAAACAACAGTGACTGTTAAATCAGTTACTTCTGCTAAAGCAGAT
ATTGAAGTACCGAAAGAAACAAAAAAAGCAGCATCAACAAAAACTGTCAAAAAAGCAACT
GAACTTAATGCAAAAGAAAAATTAGCAGCAATCAAAAGTTCTGTTGCGATGGGTGGTACT
GCAAAAGGGCGTGGGTCAGGAGTTAAGATTGATTTAGAATTAAAAGCAAAAGATCCTAAC
GCAAAAGAATATACTTACGGCACAAATTGAAAAGAAAATCGTGATAAAATTTTAACCGCT
AGTAAAACAACAAAAAAAGCCGATGACAAAACAACTAAGAAAGGGACAGGAAAAAAATAA


>protein sequence
MNDLTKKSVEELKKLEEESRAELFALRFQSAMGNLEKPHRIGELKKQIARILTILSARKN
AGENTAINVKVNLNETYAKIEKESQAFAKQRKAKIEQMMAEQQAAEGKMANLMDLPLNDA
MDLTEEQAVASTPIGETNGLDEQKAPVAAKKPAAAKDSPKQKDVAEEKTATGKAATPSAK
KAPVAKKDVAQETKTDKDAALKALIKEKAAEKKPTAKSKTSTPSDKTTVTVKSVTSAKAD
IEVPKETKKAASTKTVKKATELNAKEKLAAIKSSVAMGGTAKGRGSGVKIDLELKAKDPN
AKEYTYGTNWKENRDKILTASKTTKKADDKTTKKGTGKK






















© Fisunov Lab of Proteomics, 2016.