SPM_005045


  Uniprot: A0A037UNB3
Description: DNA-directed RNA polymerase subunit alpha
EC number: 2.7.7.6
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). {ECO:0000256|HAMAP-Rule:MF_00059}.
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. {ECO:0000256|HAMAP-Rule:MF_00059}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): rpoA
Gene names (synonym): 
Mass: 35,326
Subunit structure [CC]: SUBUNIT: Homodimer. The RNAP catalytic core consists of 2 alpha, 1 beta, 1 beta' and 1 omega subunit. When a sigma factor is associated with the core the holoenzyme is formed, which can initiate transcription. {ECO:0000256|HAMAP-Rule:MF_00059}.
Gene ontology (GO): DNA binding [GO:0003677]; DNA-directed RNA polymerase activity [GO:0003899]; transcription, DNA-templated [GO:0006351]
Gene ontology IDs: GO:0003677; GO:0003899; GO:0006351
Chain: 
Signal peptide: 
Domain [CC]: DOMAIN: The N-terminal domain is essential for RNAP assembly and basal transcription, whereas the C-terminal domain is involved in interaction with transcriptional regulators and with upstream promoter elements. {ECO:0000256|HAMAP-Rule:MF_00059}.
Sequence similarities: SIMILARITY: Belongs to the RNA polymerase alpha chain family. {ECO:0000256|HAMAP-Rule:MF_00059}.
Protein families: RNA polymerase alpha chain family
Coiled coil: COILED 243 266 {ECO:0000256|SAM:Coils}.
Domain [FT]: DOMAIN 20 232 RPOLD. {ECO:0000259|SMART:SM00662}.
Motif: 
Region: REGION 1 233 Alpha N-terminal domain (alpha-NTD). {ECO:0000256|HAMAP-Rule:MF_00059}.; REGION 252 317 Alpha C-terminal domain (alpha-CTD). {ECO:0000256|HAMAP-Rule:MF_00059}.
EMBL: AGBZ02000004
ProteinModelPortal: A0A037UNB3
MEROPS: 
EnsemblBacteria KO: KAI92106
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 2.170.120.12
InterPro: MF_00059
PANTHER: IPR011262;IPR011263;IPR011773;IPR009025;IPR011260
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF01000;PF03118;PF01193
SMART: PD001179
SUPFAM: SM00662
TIGRFAMs: SSF55257;SSF56553
70387-71341(+)

>nucleotide sequence
ATGAAACAATTTATTAGACCAGAATTTAAATTACAAGCAGAAGATAAAGCCAATAATTAC
GGAAAATTTTTAGTTGAACCATTAGAACGAGGATTTGGTGTAACATTAGGAAATGCGATA
CGTCGAACATTACTATCAGCAACACCAGGAGCCGCCGTTTTTGCTGTTCGAATTAAAGGT
GCCTCGCATGAATTTACTGCTATTCCCGGTGTTGTTGAACATGTTACAAAAATAATTTTA
AATATTAAAAATTTAGTATTAAAAATTAATCAAGATATTATTCCCGATGGAGAATCGGTA
ATTTTAAAAGTTGTTTCTTCAAAAGAAGGAGAAATTTACGCAAGAGATTTAGTTGTCCCA
ACGGGAGTAGAAGTTATTAATGGTGATTTATTATTAGCAACAATTGCTAAAGGTGGAGAA
TTAGATTTAGAGTTACATGCTCGTAATTCACGTGGGTATAAATCATTTACAGATAATAAA
AAAGAAAAAAAATATGCTGATTTAATTGTCATTGATTCAAACTATTGTCCAATTCAGCGT
GTGGCATATAATGTTGATCCAACAAAGGTTGGAAAAAATGCTGACTTAGAAAAATTAGAA
TTAGAAATTCAAACTGATAGTTCAATTACGCCAGTTAATGCTGTTGCAATGGCAGCAAAA
GTTATTACTGAGCATTTAGAATTTTTTGTTAACTTGAATGAAGCAATTAAAGCAACCCAA
ATTATTTCATCGGAAGCAGAGGCTGAAGAAGATGAATTAGAGCGTAGCATTGATGAACTA
GAATTTACGCAACGTTCACAAAATTGTTTAAAAAGAGCAAAAATTGATACCTTGCGTGAT
TTAGTTTCAAAATCAGAAGATGAAATTCAAGAAATTAGAAACTTAGGGAAAAAATCATTA
ACAGAAATTAAAGATAAAGTGGCCCAATTAGGTTTACACTTTCGACGTGATTAA


>protein sequence
MKQFIRPEFKLQAEDKANNYGKFLVEPLERGFGVTLGNAIRRTLLSATPGAAVFAVRIKG
ASHEFTAIPGVVEHVTKIILNIKNLVLKINQDIIPDGESVILKVVSSKEGEIYARDLVVP
TGVEVINGDLLLATIAKGGELDLELHARNSRGYKSFTDNKKEKKYADLIVIDSNYCPIQR
VAYNVDPTKVGKNADLEKLELEIQTDSSITPVNAVAMAAKVITEHLEFFVNLNEAIKATQ
IISSEAEAEEDELERSIDELEFTQRSQNCLKRAKIDTLRDLVSKSEDEIQEIRNLGKKSL
TEIKDKVAQLGLHFRRD






















© Fisunov Lab of Proteomics, 2016.