SPM_005095


  Uniprot: A0A037UNC7
Description: transcriptional regulator
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 31,294
Subunit structure [CC]: 
Gene ontology (GO): carbohydrate binding [GO:0030246]; DNA binding [GO:0003677]; transcription factor activity, sequence-specific DNA binding [GO:0003700]; carbohydrate metabolic process [GO:0005975]
Gene ontology IDs: GO:0003677; GO:0003700; GO:0005975; GO:0030246
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 3 79 HTH rpiR-type DNA-binding. {ECO:0000259|PROSITE:PS51071}.; DOMAIN 113 256 SIS. {ECO:0000259|PROSITE:PS51464}.
Motif: 
Region: 
EMBL: AGBZ02000004
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92116
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 1.10.10.10
InterPro: 
PANTHER: IPR009057;IPR000281;IPR001347;IPR011991
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS51071;PS51464
ProDom: PF01418;PF01380
SMART: 
SUPFAM: 
TIGRFAMs: SSF46689
78859-79675(+)

>nucleotide sequence
ATGGCATCATTTTTATCAAAATTAGAAACATTTGATTCAAAGAATTTTACTAAAAAAGAA
AATGAAATTATTAAATATATTAAAGAAAATATGAAAGAAGTAACAACAATGAATATTGAA
GTTTTAGCACAGCAGGTAAATACTGGTTATAGTGCAATATATGGTTTATTACGAAAAATG
CAAATTAATGGTTATCGAGACTTTTTAATTGCGATTGCTGCTGATATTGAAATTAAATCA
TTAGATTTTGAAAATATGGAAAGTCTAATGAAGAAGACATATTTTGATATTCTTAATCAA
AATGATACGATTATTAATAATGAAAAGATGAATCAAACAATTAATGCAATTAAAGGAGCA
TATCGAATTTTTGTAATTGGAATGGGTTCAACAAATGCTTTATCACAAACATTAGCGTTA
GAATTATATCGTTTTGGCTTTAATGCTTTTAATCTAAATGAGAATGAAGAAGACTTAATG
GTTCGTTCTCGTTTTATGAATAAAAATGATTTAATTTTAGCCTATTCATTATTCGGTGAT
AATGAAGCAGTTAATAAAGCATTAACAATTGCAAAAGAAAAAGGAGTAACTATTGTAGTA
ATTTCTGGGAAAGATATGTCAAAAGCAGTTAAATTAGCGAATTGGTCACACATTATTTCA
ACCCCAAATCAACGGGTAAATGATCATAAAATTTATGTTAACAAATTATTACCTTGAATG
TATTTTACTGATGATTTAATTAATAAAGTTTGATCATCAGATATTGTTGATAAAGATTTT
GTAATGGCTCAACAAGACAATCGTTGAGATTATTAA


>protein sequence
MASFLSKLETFDSKNFTKKENEIIKYIKENMKEVTTMNIEVLAQQVNTGYSAIYGLLRKM
QINGYRDFLIAIAADIEIKSLDFENMESLMKKTYFDILNQNDTIINNEKMNQTINAIKGA
YRIFVIGMGSTNALSQTLALELYRFGFNAFNLNENEEDLMVRSRFMNKNDLILAYSLFGD
NEAVNKALTIAKEKGVTIVVISGKDMSKAVKLANWSHIISTPNQRVNDHKIYVNKLLPWM
YFTDDLINKVWSSDIVDKDFVMAQQDNRWDY






















© Fisunov Lab of Proteomics, 2016.