SPM_005595


  Uniprot: A0A037UJP3
Description: uridylate kinase
EC number: 2.7.4.22
Annotation score: 3 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: ATP + UMP = ADP + UDP. {ECO:0000256|HAMAP-Rule:MF_01220, ECO:0000256|SAAS:SAAS00197246}.
Cofactor: 
Enzyme regulation: ENZYME REGULATION: Inhibited by UTP. {ECO:0000256|HAMAP-Rule:MF_01220}.
Function [CC]: FUNCTION: Catalyzes the reversible phosphorylation of UMP to UDP. {ECO:0000256|HAMAP-Rule:MF_01220, ECO:0000256|SAAS:SAAS00558287}.
Pathway: PATHWAY: Pyrimidine metabolism; CTP biosynthesis via de novo pathway; UDP from UMP (UMPK route): step 1/1. {ECO:0000256|HAMAP-Rule:MF_01220, ECO:0000256|SAAS:SAAS00197268}.
Active site: 
Binding site: BINDING 52 52 UMP; via amide nitrogen. {ECO:0000256|HAMAP-Rule:MF_01220}.; BINDING 53 53 ATP; via amide nitrogen. {ECO:0000256|HAMAP-Rule:MF_01220}.; BINDING 57 57 ATP. {ECO:0000256|HAMAP-Rule:MF_01220}.; BINDING 72 72 UMP. {ECO:0000256|HAMAP-Rule:MF_01220}.; BINDING 162 162 ATP. {ECO:0000256|HAMAP-Rule:MF_01220}.; BINDING 168 168 ATP; via amide nitrogen and carbonyl oxygen. {ECO:0000256|HAMAP-Rule:MF_01220}.; BINDING 171 171 ATP. {ECO:0000256|HAMAP-Rule:MF_01220}.
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: NP_BIND 11 14 ATP. {ECO:0000256|HAMAP-Rule:MF_01220}.; NP_BIND 134 141 UMP. {ECO:0000256|HAMAP-Rule:MF_01220}.
Site: 
Gene names (primary): pyrH
Gene names (synonym): 
Mass: 26,082
Subunit structure [CC]: SUBUNIT: Homohexamer. {ECO:0000256|HAMAP-Rule:MF_01220, ECO:0000256|SAAS:SAAS00558304}.
Gene ontology (GO): cytoplasm [GO:0005737]; ATP binding [GO:0005524]; UMP kinase activity [GO:0033862]; 'de novo' CTP biosynthetic process [GO:0044210]
Gene ontology IDs: GO:0005524; GO:0005737; GO:0033862; GO:0044210
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the UMP kinase family. {ECO:0000256|HAMAP-Rule:MF_01220, ECO:0000256|SAAS:SAAS00558321}.
Protein families: UMP kinase family
Coiled coil: 
Domain [FT]: DOMAIN 6 216 AA_kinase. {ECO:0000259|Pfam:PF00696}.
Motif: 
Region: 
EMBL: AGBZ02000004
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92204
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.40.1160.10
InterPro: MF_01220_B
PANTHER: IPR001048;IPR011817;IPR015963
PIRSF: PTHR21499:SF23
PRINTS: PIRSF005650
PROSITE: 
Pfam: 
ProDom: PF00696
SMART: 
SUPFAM: 
TIGRFAMs: SSF53633
179269-179995(+)

>nucleotide sequence
ATGGCATTACAATATAAGCGAGTTTTACTAAAATTATCTGGTGAAGCATTGGGCAATTCT
GATGATTTATATGATGCGAAAAAAATTTATGATATTGCAAAACAAATTGTTAAATTGCAA
AAAGAAGGATTACAAATTGCTATTGTTGTTGGTGGTGGTAATATTTGACGCGGTAATCGT
GCTGATACAATCAAAATGAATCCAATTAGTGCAGATTATATGGGGATGCTAGCAACGGTA
ATGAATGCCTTAGCATTAGAAGCTGTATTAAAGAATGAAGGTAGTCAAAATGTTGTCGTA
ACTTCAAAAATTCAAGTTCCTGAAGTTGCTTCACCATATTTATTTAAAAAAGCAAAAGCT
GCTTTAGAAAAAGGGGCAATTGTTATTATGGCTGGGGGAACTGGTCAACCAAAGTTTACA
ACTGATACAGCAGCAACAATTAGAGCAATTGAAATTGATGCCGATGTTATGCTAATGGCA
AAAAATGGGGTTGATGGGATTTATGATAAAGATCCTCGCCACAATGCCGATGCAGTTCGC
TTCGATAATATTAGTTTAAATGAATTACAAAAAAAACAATTAAAAGTAATGGATTTAACA
GCATCTAGTTTAGCAATGGAAGATGATGTTAAAATCGTTGTTTTTGATATTAATGAACCA
GATAATATTTATAAGGCAGCACATGGTAATGCTCGTTCAACGATTGTTACAGGAGGGAAA
AAATAA


>protein sequence
MALQYKRVLLKLSGEALGNSDDLYDAKKIYDIAKQIVKLQKEGLQIAIVVGGGNIWRGNR
ADTIKMNPISADYMGMLATVMNALALEAVLKNEGSQNVVVTSKIQVPEVASPYLFKKAKA
ALEKGAIVIMAGGTGQPKFTTDTAATIRAIEIDADVMLMAKNGVDGIYDKDPRHNADAVR
FDNISLNELQKKQLKVMDLTASSLAMEDDVKIVVFDINEPDNIYKAAHGNARSTIVTGGK
K






















© Fisunov Lab of Proteomics, 2016.