SPM_005850


  Uniprot: A0A037UJZ4
Description: deoxyguanosine kinase
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: ACT_SITE 77 77 Proton acceptor. {ECO:0000256|PIRSR:PIRSR000705-1}.
Binding site: BINDING 31 31 Substrate. {ECO:0000256|PIRSR:PIRSR000705-2}.; BINDING 43 43 Substrate. {ECO:0000256|PIRSR:PIRSR000705-2}.; BINDING 54 54 Substrate. {ECO:0000256|PIRSR:PIRSR000705-2}.; BINDING 78 78 Substrate. {ECO:0000256|PIRSR:PIRSR000705-2}.; BINDING 83 83 Substrate. {ECO:0000256|PIRSR:PIRSR000705-2}.; BINDING 149 149 Substrate. {ECO:0000256|PIRSR:PIRSR000705-2}.
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 23,759
Subunit structure [CC]: 
Gene ontology (GO): ATP binding [GO:0005524]; nucleoside kinase activity [GO:0019206]
Gene ontology IDs: GO:0005524; GO:0019206
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 3 184 dNK. {ECO:0000259|Pfam:PF01712}.
Motif: 
Region: 
EMBL: AGBZ02000004
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92249
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.40.50.300
InterPro: 
PANTHER: IPR002624;IPR031314;IPR027417
PIRSF: 
PRINTS: PIRSF000705
PROSITE: 
Pfam: 
ProDom: PF01712
SMART: 
SUPFAM: 
TIGRFAMs: SSF52540
232331-232940(+)

>nucleotide sequence
ATGCGGATTACATTAGCAGGAGTTGTTGGAGTTGGAAAATCAACTGTTAGTAAGCTATTG
GGAAAAAAGCATCATTATATGGTAATGGATGAGCCAGTTGAGGAGAATCCATATTTAGAT
CAGTATTATGCTGATCCAAAAGATATGGCTTTTAAAATGCAAGTATATATGGTAATGGCG
CGTAGTAAACAATTAAAACAAGCAAAAATAACATCTAATATTATTTTTGACCGTAGTATT
TTAGAAGACCCAATTTTTGTTGATGTTTTATATGAGTTAGGATATATGAATACAACAGAT
TATAAAGTTTATAAAGAATTTTATGATGTTGTTGTTTTACAAAGTTTATATTTAGATGAA
AACATTAAACCAGAATTAGTTGTTTATTTACGAGTTGATCCAGAGATAGCAATGGAACGA
ATTACCAAAAGAGGCCGCGCTAGTGAACAAAATATTGGCAGCGCTTATTGAACATTATTA
AACCGAAAATATGAGGAATGATATGAACGCTCAAAAGATAAGTTTAATTTTTTAGTTATT
GATGCCAATCATAAAACACCAGAAGAAATTGTTGCCATAATTTCAGAAAAATTAATTGAA
AAGAAATAA


>protein sequence
MRITLAGVVGVGKSTVSKLLGKKHHYMVMDEPVEENPYLDQYYADPKDMAFKMQVYMVMA
RSKQLKQAKITSNIIFDRSILEDPIFVDVLYELGYMNTTDYKVYKEFYDVVVLQSLYLDE
NIKPELVVYLRVDPEIAMERITKRGRASEQNIGSAYWTLLNRKYEEWYERSKDKFNFLVI
DANHKTPEEIVAIISEKLIEKK






















© Fisunov Lab of Proteomics, 2016.